identIPy

DNS Records

financialservicesindustry.net has IPv4 address 195.149.84.100
financialservicesindustry.net has IPv6 address 2001:67c:38c::64
financialservicesindustry.net name server redbusprimarydns.financialservicesindustry.net
financialservicesindustry.net name server redbussecondarydns.financialservicesindustry.net
redbusprimarydns.financialservicesindustry.net has IPv4 address 195.149.84.231
redbusprimarydns.financialservicesindustry.net has IPv6 address 2001:67c:38c::e7
redbussecondarydns.financialservicesindustry.net has IPv4 address 195.149.84.232
redbussecondarydns.financialservicesindustry.net has IPv6 address 2001:67c:38c::e8

Name Servers

redbusprimarydns.financialservicesindustry.net (Used By 1 Domain)
redbussecondarydns.financialservicesindustry.net (Used By 1 Domain)